Skip to content

FDOT Standard Plans · FY 2026-27 · Series 509: Incidental Construction

FDOT Standard Plans Index 509-070: Railroad Grade Crossing Traffic Control Devices

Short answer

Index 509-070 is the FDOT Standard Plan for Railroad Grade Crossing Traffic Control Devices, part of Series 509 (Incidental Construction). The sections below are extracted from FDOT's Standard Plans Instructions (SPI) for this index — design criteria, assumptions and limitations, and what your plans must show.

Design Criteria

Design Criteria FDOT Design Manual (FDM) , FDOT Traffic Engineering Manual (TEM) ; FHWA Manual on Uniform Traffic Control Devices (MUTCD) ;

Design Assumptions and Limitations

Design Assumptions and Limitations Signing and Pavement Markings: Index 509-070 , provides standard signing and pavement marking for active at-grade railroad crossing (i.e., crossing with flashing-light signals, gates, or traffic control signals). Refer to the MUTCD for signing and pavement markings at passive at-grade crossings. Refer to FDM 220 for the requirements to include Railroad Dynamic Envelope (RDE) pavement markings.

In situations where the configuration of the track(s) is not parallel, maintain the typical Railroad Dynamic Envelope pattern and fill the gap between the tracks as necessary. For details of the Railroad Dynamic Envelope pavement markings, refer to Index 711-001.

Payment

Payment Item number Item Description Unit Measure 509- 70- A Traffic Control Device for Railroad Grade Crossing EA See the BOE and Specifications f or information on payment, pay item use, and compensation.

What your plans must show

Plan Content Requirements for this index — the SPI's checklist for designers.

  • Signing and Pavement Markings: Summarize quantities in the Tabulation of Quantities of the Signing and Pavement Marking Plan. Detail the pavement markings and sign locations in the Signing and Pavement Marking Plan view.
devicesgatecrossingshoulderbackflashingwarningsignaltravelwayrailroadtracksgates

How PDFDepth uses this index

When a plan set cites Index 509-070, PDFDepth's AI Plan Review cross-references the set against the Plan Content Requirements for the FDOT indexes it cites and flags items that appear to be missing — each with a citation to the sheet. A human reviewer verifies every flag before it counts.

Related indexes in Series 509

All FDOT Standard Plans indexes

Try it yourself — open your plan set in PDFDepth

Review, measure, and check plan sets against the standards they cite — free for 14 days.

Start for Free

Text extracted from FDOT Standard Plans FY 2026-27, a public-domain Florida state publication. Always verify against the current edition at fdot.gov. PDFDepth is not affiliated with FDOT.